PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4414s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 299aa    MW: 33773.9 Da    PI: 8.6376
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4414s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-3851111262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt GG++r vP+G+grrknk++s
  Araha.4414s0020.1.p  51 PTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNS 111
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3637105IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3153109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.27655109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVESKDPAIK LFGMKIPFPT VLEVADEEEE EKNQNETLTD QSEKDKTLKK PTKILPCPRC  60
NSMETKFCYY NNYNVNQPRH FCKACQRYWT SGGTMRSVPI GAGRRKNKNN SSSSTSHYHH  120
VTISETNGPV LSFSLGDDQK VSSNRFGNPK LVARIENNDE RSNNNTSNCF PGVSWPYTWN  180
PAFYPVYPYW NIPMLFSPVN SSPTSTLGKH SRDEDETVKQ KQRNVSVLVP KTLRIDDPNE  240
AAKSSIWTTL GIKSEVMFNG FASKKEVKIN NKEETETSLV LCANPAALSR SINFHEQM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2313330.0AB231333.1 Arabidopsis thaliana CDF1 mRNA for cyclic dof factor 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201049.30.0cycling DOF factor 1
SwissprotQ8W1E30.0CDF1_ARATH; Cyclic dof factor 1
TrEMBLD7MLW80.0D7MLW8_ARALL; Putative uncharacterized protein
STRINGAT5G62430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139791625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-179cycling DOF factor 1